SCOP 1.67: Domain d1ogta2: 1ogt A:1-181

Lineage for d1ogta2 (1ogt A:1-181)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (20 species)

7. Species Human (Homo sapiens), HLA-B27 [TaxId:9606] [54471] (6 PDB entries)

8. Domain d1ogta2: 1ogt A:1-181 [92940]
   Other proteins in same PDB: d1ogta1, d1ogtb_
   complexed with gol, mn

Details for d1ogta2

PDB Entry: 1ogt, 1.47 Å

PDB Description: crystal structure of hla-b*2705 complexed with the vasoactive intestinal peptide type 1 receptor (vipr) peptide (residues 400-408)

SCOP Domain Sequences for d1ogta2:

Sequence; same for both SEQRES and ATOM records:

>d1ogta2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B27}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

Timeline for d1ogta2:

• d1ogta2 is new in SCOP 1.67
  
• d1ogta2 appears in SCOP 1.69
  
• d1ogta2 appears in the current release, SCOPe 2.08