SCOPe 2.08: Domain d1ogpe1: 1ogp E:263-389

Lineage for d1ogpe1 (1ogp E:263-389)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.6: Molybdenum-containing oxidoreductases-like dimerisation domain [81286] (1 protein)
   automatically mapped to Pfam PF03404

6. Protein Sulfite oxidase, C-terminal domain [49259] (2 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101528] (1 PDB entry)

8. Domain d1ogpe1: 1ogp E:263-389 [92935]
   Other proteins in same PDB: d1ogpa2, d1ogpb2, d1ogpc2, d1ogpd2, d1ogpe2, d1ogpf2
   complexed with cs, gol, mtq

Details for d1ogpe1

PDB Entry: 1ogp, 2.6 Å

PDB Description: the crystal structure of plant sulfite oxidase provides insight into sulfite oxidation in plants and animals

PDB Compounds: (E:) sulfite oxidase

SCOPe Domain Sequences for d1ogpe1:

Sequence; same for both SEQRES and ATOM records:

>d1ogpe1 b.1.18.6 (E:263-389) Sulfite oxidase, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dfpvqsaicsvedvqmvkpgkvsikgyavsgggrgiervdisldggknwveasrtqepgk
qyisehsssdkwawvlfeatidvsqtteviakavdsaanvqpenvesvwnlrgvlntswh
rvllrlg

Timeline for d1ogpe1:

• d1ogpe1 first appeared in SCOP 1.67
  
• d1ogpe1 appears in SCOPe 2.07