![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.6: Molybdenum-containing oxidoreductases-like dimerisation domain [81286] (1 protein) automatically mapped to Pfam PF03404 |
![]() | Protein Sulfite oxidase, C-terminal domain [49259] (2 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101528] (1 PDB entry) |
![]() | Domain d1ogpe1: 1ogp E:263-389 [92935] Other proteins in same PDB: d1ogpa2, d1ogpb2, d1ogpc2, d1ogpd2, d1ogpe2, d1ogpf2 complexed with cs, gol, mtq |
PDB Entry: 1ogp (more details), 2.6 Å
SCOPe Domain Sequences for d1ogpe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ogpe1 b.1.18.6 (E:263-389) Sulfite oxidase, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} dfpvqsaicsvedvqmvkpgkvsikgyavsgggrgiervdisldggknwveasrtqepgk qyisehsssdkwawvlfeatidvsqtteviakavdsaanvqpenvesvwnlrgvlntswh rvllrlg
Timeline for d1ogpe1: