PDB entry 1ogp

View 1ogp on RCSB PDB site
Description: the crystal structure of plant sulfite oxidase provides insight into sulfite oxidation in plants and animals
Class: oxidoreductase
Keywords: oxidoreductase, molybdenum cofactor, molybdopterin, plant sulfite oxidase, peroxisomes, intramolecular electron transfer, oxidoreductas
Deposited on 2003-05-08, released 2003-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.237
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfite oxidase
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogpa1, d1ogpa2
  • Chain 'B':
    Compound: sulfite oxidase
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogpb1, d1ogpb2
  • Chain 'C':
    Compound: sulfite oxidase
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogpc1, d1ogpc2
  • Chain 'D':
    Compound: sulfite oxidase
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogpd1, d1ogpd2
  • Chain 'E':
    Compound: sulfite oxidase
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogpe1, d1ogpe2
  • Chain 'F':
    Compound: sulfite oxidase
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ogpf1, d1ogpf2
  • Heterogens: CS, GOL, MTQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ogpA (A:)
    mpgirgpseysqepprhpslkvnakepfnaepprsalvssyvtpvdlfykrnhgpipivd
    hlqsysvtltgliqnprklfikdirslpkynvtatlqcagnrrtamskvrnvrgvgwdvs
    aignavwggakladvlelvgipkltastnlgarhvefvsvdrckeenggpykasitlsqa
    tnpeadvllayemngetlnrdhgfplrvvvpgvigarsvkwldsinviaeesqgffmqkd
    ykmfppsvnwdninwssrrpqmdfpvqsaicsvedvqmvkpgkvsikgyavsgggrgier
    vdisldggknwveasrtqepgkqyisehsssdkwawvlfeatidvsqtteviakavdsaa
    nvqpenvesvwnlrgvlntswhrvllrlghsnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogpA (A:)
    pgirgpseysqepprhpslkvnakepfnaepprsalvssyvtpvdlfykrnhgpipivdh
    lqsysvtltgliqnprklfikdirslpkynvtatlqcagnrrtamskvrnvrgvgwdvsa
    ignavwggakladvlelvgipkltastnlgarhvefvsvdrckeenggpykasitlsqat
    npeadvllayemngetlnrdhgfplrvvvpgvigarsvkwldsinviaeesqgffmqkdy
    kmfppsvnwdninwssrrpqmdfpvqsaicsvedvqmvkpgkvsikgyavsgggrgierv
    disldggknwveasrtqepgkqyisehsssdkwawvlfeatidvsqtteviakavdsaan
    vqpenvesvwnlrgvlntswhrvllrlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ogpB (B:)
    mpgirgpseysqepprhpslkvnakepfnaepprsalvssyvtpvdlfykrnhgpipivd
    hlqsysvtltgliqnprklfikdirslpkynvtatlqcagnrrtamskvrnvrgvgwdvs
    aignavwggakladvlelvgipkltastnlgarhvefvsvdrckeenggpykasitlsqa
    tnpeadvllayemngetlnrdhgfplrvvvpgvigarsvkwldsinviaeesqgffmqkd
    ykmfppsvnwdninwssrrpqmdfpvqsaicsvedvqmvkpgkvsikgyavsgggrgier
    vdisldggknwveasrtqepgkqyisehsssdkwawvlfeatidvsqtteviakavdsaa
    nvqpenvesvwnlrgvlntswhrvllrlghsnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogpB (B:)
    pgirgpseysqepprhpslkvnakepfnaepprsalvssyvtpvdlfykrnhgpipivdh
    lqsysvtltgliqnprklfikdirslpkynvtatlqcagnrrtamskvrnvrgvgwdvsa
    ignavwggakladvlelvgipkltastnlgarhvefvsvdrckeenggpykasitlsqat
    npeadvllayemngetlnrdhgfplrvvvpgvigarsvkwldsinviaeesqgffmqkdy
    kmfppsvnwdninwssrrpqmdfpvqsaicsvedvqmvkpgkvsikgyavsgggrgierv
    disldggknwveasrtqepgkqyisehsssdkwawvlfeatidvsqtteviakavdsaan
    vqpenvesvwnlrgvlntswhrvllrlg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ogpC (C:)
    mpgirgpseysqepprhpslkvnakepfnaepprsalvssyvtpvdlfykrnhgpipivd
    hlqsysvtltgliqnprklfikdirslpkynvtatlqcagnrrtamskvrnvrgvgwdvs
    aignavwggakladvlelvgipkltastnlgarhvefvsvdrckeenggpykasitlsqa
    tnpeadvllayemngetlnrdhgfplrvvvpgvigarsvkwldsinviaeesqgffmqkd
    ykmfppsvnwdninwssrrpqmdfpvqsaicsvedvqmvkpgkvsikgyavsgggrgier
    vdisldggknwveasrtqepgkqyisehsssdkwawvlfeatidvsqtteviakavdsaa
    nvqpenvesvwnlrgvlntswhrvllrlghsnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogpC (C:)
    pgirgpseysqepprhpslkvnakepfnaepprsalvssyvtpvdlfykrnhgpipivdh
    lqsysvtltgliqnprklfikdirslpkynvtatlqcagnrrtamskvrnvrgvgwdvsa
    ignavwggakladvlelvgipkltastnlgarhvefvsvdrckeenggpykasitlsqat
    npeadvllayemngetlnrdhgfplrvvvpgvigarsvkwldsinviaeesqgffmqkdy
    kmfppsvnwdninwssrrpqmdfpvqsaicsvedvqmvkpgkvsikgyavsgggrgierv
    disldggknwveasrtqepgkqyisehsssdkwawvlfeatidvsqtteviakavdsaan
    vqpenvesvwnlrgvlntswhrvllrlg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ogpD (D:)
    mpgirgpseysqepprhpslkvnakepfnaepprsalvssyvtpvdlfykrnhgpipivd
    hlqsysvtltgliqnprklfikdirslpkynvtatlqcagnrrtamskvrnvrgvgwdvs
    aignavwggakladvlelvgipkltastnlgarhvefvsvdrckeenggpykasitlsqa
    tnpeadvllayemngetlnrdhgfplrvvvpgvigarsvkwldsinviaeesqgffmqkd
    ykmfppsvnwdninwssrrpqmdfpvqsaicsvedvqmvkpgkvsikgyavsgggrgier
    vdisldggknwveasrtqepgkqyisehsssdkwawvlfeatidvsqtteviakavdsaa
    nvqpenvesvwnlrgvlntswhrvllrlghsnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogpD (D:)
    pgirgpseysqepprhpslkvnakepfnaepprsalvssyvtpvdlfykrnhgpipivdh
    lqsysvtltgliqnprklfikdirslpkynvtatlqcagnrrtamskvrnvrgvgwdvsa
    ignavwggakladvlelvgipkltastnlgarhvefvsvdrckeenggpykasitlsqat
    npeadvllayemngetlnrdhgfplrvvvpgvigarsvkwldsinviaeesqgffmqkdy
    kmfppsvnwdninwssrrpqmdfpvqsaicsvedvqmvkpgkvsikgyavsgggrgierv
    disldggknwveasrtqepgkqyisehsssdkwawvlfeatidvsqtteviakavdsaan
    vqpenvesvwnlrgvlntswhrvllrlg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ogpE (E:)
    mpgirgpseysqepprhpslkvnakepfnaepprsalvssyvtpvdlfykrnhgpipivd
    hlqsysvtltgliqnprklfikdirslpkynvtatlqcagnrrtamskvrnvrgvgwdvs
    aignavwggakladvlelvgipkltastnlgarhvefvsvdrckeenggpykasitlsqa
    tnpeadvllayemngetlnrdhgfplrvvvpgvigarsvkwldsinviaeesqgffmqkd
    ykmfppsvnwdninwssrrpqmdfpvqsaicsvedvqmvkpgkvsikgyavsgggrgier
    vdisldggknwveasrtqepgkqyisehsssdkwawvlfeatidvsqtteviakavdsaa
    nvqpenvesvwnlrgvlntswhrvllrlghsnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogpE (E:)
    pgirgpseysqepprhpslkvnakepfnaepprsalvssyvtpvdlfykrnhgpipivdh
    lqsysvtltgliqnprklfikdirslpkynvtatlqcagnrrtamskvrnvrgvgwdvsa
    ignavwggakladvlelvgipkltastnlgarhvefvsvdrckeenggpykasitlsqat
    npeadvllayemngetlnrdhgfplrvvvpgvigarsvkwldsinviaeesqgffmqkdy
    kmfppsvnwdninwssrrpqmdfpvqsaicsvedvqmvkpgkvsikgyavsgggrgierv
    disldggknwveasrtqepgkqyisehsssdkwawvlfeatidvsqtteviakavdsaan
    vqpenvesvwnlrgvlntswhrvllrlg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ogpF (F:)
    mpgirgpseysqepprhpslkvnakepfnaepprsalvssyvtpvdlfykrnhgpipivd
    hlqsysvtltgliqnprklfikdirslpkynvtatlqcagnrrtamskvrnvrgvgwdvs
    aignavwggakladvlelvgipkltastnlgarhvefvsvdrckeenggpykasitlsqa
    tnpeadvllayemngetlnrdhgfplrvvvpgvigarsvkwldsinviaeesqgffmqkd
    ykmfppsvnwdninwssrrpqmdfpvqsaicsvedvqmvkpgkvsikgyavsgggrgier
    vdisldggknwveasrtqepgkqyisehsssdkwawvlfeatidvsqtteviakavdsaa
    nvqpenvesvwnlrgvlntswhrvllrlghsnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ogpF (F:)
    pgirgpseysqepprhpslkvnakepfnaepprsalvssyvtpvdlfykrnhgpipivdh
    lqsysvtltgliqnprklfikdirslpkynvtatlqcagnrrtamskvrnvrgvgwdvsa
    ignavwggakladvlelvgipkltastnlgarhvefvsvdrckeenggpykasitlsqat
    npeadvllayemngetlnrdhgfplrvvvpgvigarsvkwldsinviaeesqgffmqkdy
    kmfppsvnwdninwssrrpqmdfpvqsaicsvedvqmvkpgkvsikgyavsgggrgierv
    disldggknwveasrtqepgkqyisehsssdkwawvlfeatidvsqtteviakavdsaan
    vqpenvesvwnlrgvlntswhrvllrlg