Lineage for d1ogpf2 (1ogp F:2-262)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2561501Fold d.176: Oxidoreductase molybdopterin-binding domain [56523] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure and a beta-grasp like motif
  4. 2561502Superfamily d.176.1: Oxidoreductase molybdopterin-binding domain [56524] (2 families) (S)
  5. 2561503Family d.176.1.1: Oxidoreductase molybdopterin-binding domain [56525] (2 protein domains)
    Pfam PF00174
  6. 2561521Protein Sulfite oxidase, middle catalytic domain [56526] (2 species)
  7. 2561533Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [103363] (1 PDB entry)
  8. 2561539Domain d1ogpf2: 1ogp F:2-262 [92938]
    Other proteins in same PDB: d1ogpa1, d1ogpb1, d1ogpc1, d1ogpd1, d1ogpe1, d1ogpf1
    complexed with cs, gol, mtq

Details for d1ogpf2

PDB Entry: 1ogp (more details), 2.6 Å

PDB Description: the crystal structure of plant sulfite oxidase provides insight into sulfite oxidation in plants and animals
PDB Compounds: (F:) sulfite oxidase

SCOPe Domain Sequences for d1ogpf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogpf2 d.176.1.1 (F:2-262) Sulfite oxidase, middle catalytic domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pgirgpseysqepprhpslkvnakepfnaepprsalvssyvtpvdlfykrnhgpipivdh
lqsysvtltgliqnprklfikdirslpkynvtatlqcagnrrtamskvrnvrgvgwdvsa
ignavwggakladvlelvgipkltastnlgarhvefvsvdrckeenggpykasitlsqat
npeadvllayemngetlnrdhgfplrvvvpgvigarsvkwldsinviaeesqgffmqkdy
kmfppsvnwdninwssrrpqm

SCOPe Domain Coordinates for d1ogpf2:

Click to download the PDB-style file with coordinates for d1ogpf2.
(The format of our PDB-style files is described here.)

Timeline for d1ogpf2: