Lineage for d1ofnb_ (1ofn B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814472Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)
  6. 2814527Protein dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD [101973] (1 species)
  7. 2814528Species Amycolatopsis orientalis [TaxId:31958] [101974] (2 PDB entries)
    Uniprot O52806
  8. 2814532Domain d1ofnb_: 1ofn B: [92831]
    complexed with gol

Details for d1ofnb_

PDB Entry: 1ofn (more details), 1.5 Å

PDB Description: purification, crystallisation and preliminary structural studies of dtdp-4-keto-6-deoxy-glucose-5-epimerase (evad) from amycolatopsis orientalis; the fourth enzyme in the dtdp-l-epivancosamine biosynthetic pathway.
PDB Compounds: (B:) pcza361.16

SCOPe Domain Sequences for d1ofnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofnb_ b.82.1.1 (B:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]}
mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr
gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh
afvaleddtvmsymlsrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq
rqgllpdyttsqeierrltavpv

SCOPe Domain Coordinates for d1ofnb_:

Click to download the PDB-style file with coordinates for d1ofnb_.
(The format of our PDB-style files is described here.)

Timeline for d1ofnb_: