![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins) |
![]() | Protein dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD [101973] (1 species) |
![]() | Species Amycolatopsis orientalis [TaxId:31958] [101974] (2 PDB entries) Uniprot O52806 |
![]() | Domain d1ofna_: 1ofn A: [92830] complexed with gol |
PDB Entry: 1ofn (more details), 1.5 Å
SCOPe Domain Sequences for d1ofna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ofna_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh afvaleddtvmsymlsrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq rqgllpdyttsqeierrltavp
Timeline for d1ofna_: