SCOPe 2.07: Domain d1ofnb_: 1ofn B:

Lineage for d1ofnb_ (1ofn B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)

6. Protein dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD [101973] (1 species)

7. Species Amycolatopsis orientalis [TaxId:31958] [101974] (2 PDB entries)
   Uniprot O52806

8. Domain d1ofnb_: 1ofn B: [92831]
   complexed with gol

Details for d1ofnb_

PDB Entry: 1ofn, 1.5 Å

PDB Description: purification, crystallisation and preliminary structural studies of dtdp-4-keto-6-deoxy-glucose-5-epimerase (evad) from amycolatopsis orientalis; the fourth enzyme in the dtdp-l-epivancosamine biosynthetic pathway.

PDB Compounds: (B:) pcza361.16

SCOPe Domain Sequences for d1ofnb_:

Sequence; same for both SEQRES and ATOM records:

>d1ofnb_ b.82.1.1 (B:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]}
mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr
gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh
afvaleddtvmsymlsrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq
rqgllpdyttsqeierrltavpv

Timeline for d1ofnb_:

• d1ofnb_ first appeared in SCOP 1.67
  
• d1ofnb_ appears in SCOPe 2.06
  
• d1ofnb_ appears in the current release, SCOPe 2.08