SCOP 1.67: Domain d1o6ue2: 1o6u E:275-397

Lineage for d1o6ue2 (1o6u E:275-397)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.132: Supernatant protein factor (SPF), C-terminal domain [101575] (1 superfamily)
   sandwich; 8 strands in 2 sheets; jelly-roll; similarity to the Nucleoplasmin-like/VP fold

4. Superfamily b.132.1: Supernatant protein factor (SPF), C-terminal domain [101576] (1 family)

5. Family b.132.1.1: Supernatant protein factor (SPF), C-terminal domain [101577] (1 protein)

6. Protein Supernatant protein factor (SPF), C-terminal domain [101578] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101579] (1 PDB entry)

8. Domain d1o6ue2: 1o6u E:275-397 [92596]
   Other proteins in same PDB: d1o6ua1, d1o6ua3, d1o6uc1, d1o6uc3, d1o6ue1, d1o6ue3
   complexed with plm

Details for d1o6ue2

PDB Entry: 1o6u, 2.05 Å

PDB Description: the crystal structure of human supernatant protein factor

SCOP Domain Sequences for d1o6ue2:

Sequence; same for both SEQRES and ATOM records:

>d1o6ue2 b.132.1.1 (E:275-397) Supernatant protein factor (SPF), C-terminal domain {Human (Homo sapiens)}
kqqyehsvqisrgsshqveyeilfpgcvlrwqfmsdgadvgfgiflktkmgerqragemt
evlpnqrynshlvpedgtltcsdpgiyvlrfdntysfihakkvnftvevllpdkaseekm
kql

Timeline for d1o6ue2:

• d1o6ue2 is new in SCOP 1.67
  
• d1o6ue2 appears in SCOP 1.69
  
• d1o6ue2 appears in the current release, SCOPe 2.08