Lineage for d1o6uc3 (1o6u C:76-274)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390204Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 390205Superfamily c.13.1: CRAL/TRIO domain [52087] (1 family) (S)
  5. 390206Family c.13.1.1: CRAL/TRIO domain [52088] (3 proteins)
    Pfam 00650
  6. 390216Protein Supernatant protein factor (SPF), middle domain [102205] (1 species)
    Sec14-like protein 2; contains extra C-terminal beta-sandwich domain
  7. 390217Species Human (Homo sapiens) [TaxId:9606] [102206] (1 PDB entry)
  8. 390219Domain d1o6uc3: 1o6u C:76-274 [92594]
    Other proteins in same PDB: d1o6ua1, d1o6ua2, d1o6uc1, d1o6uc2, d1o6ue1, d1o6ue2

Details for d1o6uc3

PDB Entry: 1o6u (more details), 2.05 Å

PDB Description: the crystal structure of human supernatant protein factor

SCOP Domain Sequences for d1o6uc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o6uc3 c.13.1.1 (C:76-274) Supernatant protein factor (SPF), middle domain {Human (Homo sapiens)}
ppeviqqylsggmcgydldgcpvwydiigpldakgllfsaskqdllrtkmrecelllqec
ahqttklgrkvetitiiydceglglkhlwkpaveaygeflcmfeenypetlkrlfvvkap
klfpvaynlikpflsedtrkkimvlganwkevllkhispdqvpveyggtmtdpdgnpkck
skinyggdiprkyyvrdqv

SCOP Domain Coordinates for d1o6uc3:

Click to download the PDB-style file with coordinates for d1o6uc3.
(The format of our PDB-style files is described here.)

Timeline for d1o6uc3: