Lineage for d1o6ue1 (1o6u E:1-75)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 352395Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
    3 helices; bundle, right-handed twist
  4. 352463Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (1 family) (S)
  5. 352464Family a.5.3.1: CRAL/TRIO N-terminal domain [46939] (3 proteins)
  6. 352474Protein Supernatant protein factor (SPF), N-terminal domain [101071] (1 species)
    Sec14-like protein 2; contains extra C-terminal beta-sandwich domain
  7. 352475Species Human (Homo sapiens) [TaxId:9606] [101072] (1 PDB entry)
  8. 352478Domain d1o6ue1: 1o6u E:1-75 [92595]
    Other proteins in same PDB: d1o6ua2, d1o6ua3, d1o6uc2, d1o6uc3, d1o6ue2, d1o6ue3
    complexed with plm

Details for d1o6ue1

PDB Entry: 1o6u (more details), 2.05 Å

PDB Description: the crystal structure of human supernatant protein factor

SCOP Domain Sequences for d1o6ue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o6ue1 a.5.3.1 (E:1-75) Supernatant protein factor (SPF), N-terminal domain {Human (Homo sapiens)}
msgrvgdlsprqkealakfrenvqdvlpalpnpddyfllrwlrarsfdlqkseamlrkhv
efrkqkdidniiswq

SCOP Domain Coordinates for d1o6ue1:

Click to download the PDB-style file with coordinates for d1o6ue1.
(The format of our PDB-style files is described here.)

Timeline for d1o6ue1: