Lineage for d1o6uc3 (1o6u C:76-274)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families) (S)
    automatically mapped to Pfam PF00650
  5. Family c.13.1.1: CRAL/TRIO domain [52088] (4 proteins)
    Pfam PF00650
  6. Protein Supernatant protein factor (SPF), middle domain [102205] (1 species)
    Sec14-like protein 2; contains extra C-terminal beta-sandwich domain
  7. Species Human (Homo sapiens) [TaxId:9606] [102206] (2 PDB entries)
    Uniprot O76054
  8. Domain d1o6uc3: 1o6u C:76-274 [92594]
    Other proteins in same PDB: d1o6ua1, d1o6ua2, d1o6uc1, d1o6uc2, d1o6ue1, d1o6ue2
    complexed with plm

Details for d1o6uc3

PDB Entry: 1o6u (more details), 2.05 Å

PDB Description: the crystal structure of human supernatant protein factor
PDB Compounds: (C:) sec14-like protein 2

SCOPe Domain Sequences for d1o6uc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o6uc3 c.13.1.1 (C:76-274) Supernatant protein factor (SPF), middle domain {Human (Homo sapiens) [TaxId: 9606]}
ppeviqqylsggmcgydldgcpvwydiigpldakgllfsaskqdllrtkmrecelllqec
ahqttklgrkvetitiiydceglglkhlwkpaveaygeflcmfeenypetlkrlfvvkap
klfpvaynlikpflsedtrkkimvlganwkevllkhispdqvpveyggtmtdpdgnpkck
skinyggdiprkyyvrdqv

SCOPe Domain Coordinates for d1o6uc3 are not available.

Timeline for d1o6uc3:

Domains from same chain:
(mouse over for more information)
d1o6uc1, d1o6uc2
Domains from other chains:
(mouse over for more information)
d1o6ua1, d1o6ua2, d1o6ua3, d1o6ue1, d1o6ue2, d1o6ue3