Class b: All beta proteins [48724] (144 folds) |
Fold b.132: Supernatant protein factor (SPF), C-terminal domain [101575] (1 superfamily) sandwich; 8 strands in 2 sheets; jelly-roll; similarity to the Nucleoplasmin-like/VP fold |
Superfamily b.132.1: Supernatant protein factor (SPF), C-terminal domain [101576] (1 family) |
Family b.132.1.1: Supernatant protein factor (SPF), C-terminal domain [101577] (1 protein) |
Protein Supernatant protein factor (SPF), C-terminal domain [101578] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101579] (2 PDB entries) |
Domain d1o6ue2: 1o6u E:275-397 [92596] Other proteins in same PDB: d1o6ua1, d1o6ua3, d1o6uc1, d1o6uc3, d1o6ue1, d1o6ue3 |
PDB Entry: 1o6u (more details), 2.05 Å
SCOP Domain Sequences for d1o6ue2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o6ue2 b.132.1.1 (E:275-397) Supernatant protein factor (SPF), C-terminal domain {Human (Homo sapiens)} kqqyehsvqisrgsshqveyeilfpgcvlrwqfmsdgadvgfgiflktkmgerqragemt evlpnqrynshlvpedgtltcsdpgiyvlrfdntysfihakkvnftvevllpdkaseekm kql
Timeline for d1o6ue2: