SCOPe 2.08: Domain d1o4xa2: 1o4x A:5-79

Lineage for d1o4xa2 (1o4x A:5-79)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.1: POU-specific domain [47414] (3 proteins)

6. Protein Oct-1 [47415] (1 species)
   canonical 4-helical fold

7. Species Human (Homo sapiens) [TaxId:9606] [47416] (7 PDB entries)

8. Domain d1o4xa2: 1o4x A:5-79 [92471]
   Other proteins in same PDB: d1o4xa1, d1o4xb_
   protein/DNA complex

Details for d1o4xa2

PDB Entry: 1o4x

PDB Description: ternary complex of the dna binding domains of the oct1 and sox2 transcription factors with a 19mer oligonucleotide from the hoxb1 regulatory element

PDB Compounds: (A:) transcription factor Oct-1

SCOPe Domain Sequences for d1o4xa2:

Sequence; same for both SEQRES and ATOM records:

>d1o4xa2 a.35.1.1 (A:5-79) Oct-1 {Human (Homo sapiens) [TaxId: 9606]}
eepsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknm
aklkpllekwlndae

Timeline for d1o4xa2:

• d1o4xa2 first appeared in SCOP 1.67
  
• d1o4xa2 appears in SCOPe 2.07