Lineage for d1o4xa2 (1o4x A:5-79)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322501Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2322502Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2322503Family a.35.1.1: POU-specific domain [47414] (3 proteins)
  6. 2322508Protein Oct-1 [47415] (1 species)
    canonical 4-helical fold
  7. 2322509Species Human (Homo sapiens) [TaxId:9606] [47416] (7 PDB entries)
  8. 2322517Domain d1o4xa2: 1o4x A:5-79 [92471]
    Other proteins in same PDB: d1o4xa1, d1o4xb_
    protein/DNA complex

Details for d1o4xa2

PDB Entry: 1o4x (more details)

PDB Description: ternary complex of the dna binding domains of the oct1 and sox2 transcription factors with a 19mer oligonucleotide from the hoxb1 regulatory element
PDB Compounds: (A:) transcription factor Oct-1

SCOPe Domain Sequences for d1o4xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o4xa2 a.35.1.1 (A:5-79) Oct-1 {Human (Homo sapiens) [TaxId: 9606]}
eepsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknm
aklkpllekwlndae

SCOPe Domain Coordinates for d1o4xa2:

Click to download the PDB-style file with coordinates for d1o4xa2.
(The format of our PDB-style files is described here.)

Timeline for d1o4xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o4xa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1o4xb_