Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (11 families) |
Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
Protein Mitochondria fission protein Fis1 [101417] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [101418] (2 PDB entries) |
Domain d1nzna1: 1nzn A:4-124 [92382] Other proteins in same PDB: d1nzna2 complexed with gol, so4 |
PDB Entry: 1nzn (more details), 2 Å
SCOPe Domain Sequences for d1nzna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nzna1 a.118.8.1 (A:4-124) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} meavlnelvsvedllkfekkfqsekaagsvskstqfeyawclvrtrynddirkgivllee llpkgskeeqrdyvfylavgnyrlkeyekalkyvrgllqtepqnnqakelerlidkamkk d
Timeline for d1nzna1: