SCOPe 2.07: Domain d1nzna1: 1nzn A:4-124

Lineage for d1nzna1 (1nzn A:4-124)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (10 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Mitochondria fission protein Fis1 [101417] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101418] (2 PDB entries)

8. Domain d1nzna1: 1nzn A:4-124 [92382]
   Other proteins in same PDB: d1nzna2
   complexed with gol, so4

Details for d1nzna1

PDB Entry: 1nzn, 2 Å

PDB Description: Cytosolic domain of the human mitchondrial fission protein Fis1 adopts a TPR fold

PDB Compounds: (A:) Fission protein Fis1p

SCOPe Domain Sequences for d1nzna1:

Sequence; same for both SEQRES and ATOM records:

>d1nzna1 a.118.8.1 (A:4-124) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}
meavlnelvsvedllkfekkfqsekaagsvskstqfeyawclvrtrynddirkgivllee
llpkgskeeqrdyvfylavgnyrlkeyekalkyvrgllqtepqnnqakelerlidkamkk
d

Timeline for d1nzna1:

• d1nzna1 first appeared in SCOP 1.67, called d1nzna_
  
• d1nzna1 appears in SCOPe 2.06
  
• d1nzna1 appears in the current release, SCOPe 2.08