Lineage for d1nxha_ (1nxh A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.200: Hypothetical protein MTH393 [101331] (1 superfamily)
multihelical; consists of two all-alpha subdomains; dimerSuperfamily a.200.1: Hypothetical protein MTH393 [101332] (1 family) 
automatically mapped to Pfam PF09218Family a.200.1.1: Hypothetical protein MTH393 [101333] (1 protein) Protein Hypothetical protein MTH393 [101334] (1 species) Species Methanobacterium thermoautotrophicum [TaxId:145262] [101335] (1 PDB entry) 
Domain d1nxha_: 1nxh A: [92300]
Details for d1nxha_
PDB Entry: 1nxh (more details), 2.8 Å
PDB Description: x-ray structure: northeast structural genomics consortium target tt87
PDB Compounds: (A:) MTH396 proteinSCOPe Domain Sequences for d1nxha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nxha_ a.200.1.1 (A:) Hypothetical protein MTH393 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
egelmrlmkrrilesyrwqedvvkplsreleidveefqdilmdkldmsslealhprfesa
rprcireklhsdlqlcwlvdvmeiisvddaealkdeitelvlagreysealsegrrrlhe
ilrs
SCOPe Domain Coordinates for d1nxha_:
Click to download the PDB-style file with coordinates for d1nxha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nxha_:
- d1nxha_ first appeared in SCOP 1.67
- d1nxha_ appears in SCOPe 2.07
View in 3D
