![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.200: Hypothetical protein MTH393 [101331] (1 superfamily) multihelical; consists of two all-alpha subdomains; dimer |
![]() | Superfamily a.200.1: Hypothetical protein MTH393 [101332] (1 family) ![]() automatically mapped to Pfam PF09218 |
![]() | Family a.200.1.1: Hypothetical protein MTH393 [101333] (1 protein) |
![]() | Protein Hypothetical protein MTH393 [101334] (1 species) |
![]() | Species Methanobacterium thermoautotrophicum [TaxId:145262] [101335] (1 PDB entry) |
![]() | Domain d1nxhb_: 1nxh B: [92301] |
PDB Entry: 1nxh (more details), 2.8 Å
SCOPe Domain Sequences for d1nxhb_:
Sequence, based on SEQRES records: (download)
>d1nxhb_ a.200.1.1 (B:) Hypothetical protein MTH393 {Methanobacterium thermoautotrophicum [TaxId: 145262]} elmrlmkrrilesyrwqedvvkplsreleidveefqdilmdkldmsslealhprfesarp rcireklhsdlqlcwlvdvmeiisvddaealkdeitelvlagreysealsegrrrlheil rs
>d1nxhb_ a.200.1.1 (B:) Hypothetical protein MTH393 {Methanobacterium thermoautotrophicum [TaxId: 145262]} elmrlmkrrilesyrwqedvvkplsreveefqdilmdkldmsslealhprfesarprcir eklhsdlqlcwlvdvmeiisvddaealkdeitelvlagreysealsegrrrlheilrs
Timeline for d1nxhb_: