Lineage for d1nxhb_ (1nxh B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.200: Hypothetical protein MTH393 [101331] (1 superfamily)
    multihelical; consists of two all-alpha subdomains; dimer
  4. Superfamily a.200.1: Hypothetical protein MTH393 [101332] (1 family) (S)
    automatically mapped to Pfam PF09218
  5. Family a.200.1.1: Hypothetical protein MTH393 [101333] (1 protein)
  6. Protein Hypothetical protein MTH393 [101334] (1 species)
  7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [101335] (1 PDB entry)
  8. Domain d1nxhb_: 1nxh B: [92301]

Details for d1nxhb_

PDB Entry: 1nxh (more details), 2.8 Å

PDB Description: x-ray structure: northeast structural genomics consortium target tt87
PDB Compounds: (B:) MTH396 protein

SCOPe Domain Sequences for d1nxhb_:

Sequence, based on SEQRES records: (download)

>d1nxhb_ a.200.1.1 (B:) Hypothetical protein MTH393 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
elmrlmkrrilesyrwqedvvkplsreleidveefqdilmdkldmsslealhprfesarp
rcireklhsdlqlcwlvdvmeiisvddaealkdeitelvlagreysealsegrrrlheil
rs

Sequence, based on observed residues (ATOM records): (download)

>d1nxhb_ a.200.1.1 (B:) Hypothetical protein MTH393 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
elmrlmkrrilesyrwqedvvkplsreveefqdilmdkldmsslealhprfesarprcir
eklhsdlqlcwlvdvmeiisvddaealkdeitelvlagreysealsegrrrlheilrs

SCOPe Domain Coordinates for d1nxhb_ are not available.

Timeline for d1nxhb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nxha_