SCOPe 2.07: Domain d1nxhb_: 1nxh B:

Lineage for d1nxhb_ (1nxh B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.200: Hypothetical protein MTH393 [101331] (1 superfamily)
   multihelical; consists of two all-alpha subdomains; dimer

4. Superfamily a.200.1: Hypothetical protein MTH393 [101332] (1 family)
   automatically mapped to Pfam PF09218

5. Family a.200.1.1: Hypothetical protein MTH393 [101333] (1 protein)

6. Protein Hypothetical protein MTH393 [101334] (1 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [101335] (1 PDB entry)

8. Domain d1nxhb_: 1nxh B: [92301]

Details for d1nxhb_

PDB Entry: 1nxh, 2.8 Å

PDB Description: x-ray structure: northeast structural genomics consortium target tt87

PDB Compounds: (B:) MTH396 protein

SCOPe Domain Sequences for d1nxhb_:

Sequence, based on SEQRES records:

>d1nxhb_ a.200.1.1 (B:) Hypothetical protein MTH393 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
elmrlmkrrilesyrwqedvvkplsreleidveefqdilmdkldmsslealhprfesarp
rcireklhsdlqlcwlvdvmeiisvddaealkdeitelvlagreysealsegrrrlheil
rs

Sequence, based on observed residues (ATOM records):

>d1nxhb_ a.200.1.1 (B:) Hypothetical protein MTH393 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
elmrlmkrrilesyrwqedvvkplsreveefqdilmdkldmsslealhprfesarprcir
eklhsdlqlcwlvdvmeiisvddaealkdeitelvlagreysealsegrrrlheilrs

Timeline for d1nxhb_:

• d1nxhb_ first appeared in SCOP 1.67
  
• d1nxhb_ appears in SCOPe 2.06