PDB entry 1nxh

View 1nxh on RCSB PDB site
Description: x-ray structure: northeast structural genomics consortium target tt87
Class: structural genomics, unknown function
Keywords: Hypothetical protein, Disulfide bonds, Homodimer, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2003-02-10, released 2004-02-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MTH396 protein
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: MTH396
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26496 (Start-125)
      • modified residue (6)
      • modified residue (9)
      • modified residue (43)
      • modified residue (48)
      • modified residue (83)
    • GB NP_275539
    Domains in SCOPe 2.08: d1nxha_
  • Chain 'B':
    Compound: MTH396 protein
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: MTH396
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26496
    • GB NP_275539 (Start-125)
      • modified residue (6)
      • modified residue (9)
      • modified residue (43)
      • modified residue (48)
      • modified residue (83)
    Domains in SCOPe 2.08: d1nxhb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nxhA (A:)
    mdegelmrlmkrrilesyrwqedvvkplsreleidveefqdilmdkldmsslealhprfe
    sarprcireklhsdlqlcwlvdvmeiisvddaealkdeitelvlagreysealsegrrrl
    heilrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nxhA (A:)
    egelmrlmkrrilesyrwqedvvkplsreleidveefqdilmdkldmsslealhprfesa
    rprcireklhsdlqlcwlvdvmeiisvddaealkdeitelvlagreysealsegrrrlhe
    ilrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nxhB (B:)
    mdegelmrlmkrrilesyrwqedvvkplsreleidveefqdilmdkldmsslealhprfe
    sarprcireklhsdlqlcwlvdvmeiisvddaealkdeitelvlagreysealsegrrrl
    heilrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nxhB (B:)
    elmrlmkrrilesyrwqedvvkplsreveefqdilmdkldmsslealhprfesarprcir
    eklhsdlqlcwlvdvmeiisvddaealkdeitelvlagreysealsegrrrlheilrs