SCOP 1.73: Domain d1ntme2: 1ntm E:1-69

Lineage for d1ntme2 (1ntm E:1-69)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family)

5. Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)

6. Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81497] (12 PDB entries)

8. Domain d1ntme2: 1ntm E:1-69 [92130]
   Other proteins in same PDB: d1ntma1, d1ntma2, d1ntmb1, d1ntmb2, d1ntmc1, d1ntmc2, d1ntmd1, d1ntmd2, d1ntme1, d1ntmf_, d1ntmg_, d1ntmh_, d1ntmi_, d1ntmj_, d1ntmk_
   complexed with fes, hem

Details for d1ntme2

PDB Entry: 1ntm, 2.4 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex at 2.4 Angstrom

PDB Compounds: (E:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial

SCOP Domain Sequences for d1ntme2:

Sequence; same for both SEQRES and ATOM records:

>d1ntme2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

Timeline for d1ntme2:

• d1ntme2 first appeared in SCOP 1.67
  
• d1ntme2 appears in SCOP 1.71
  
• d1ntme2 appears in SCOP 1.75
  
• d1ntme2 appears in the current release, SCOPe 2.08