Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species) also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits |
Species Cow (Bos taurus) [TaxId:9913] [81638] (17 PDB entries) |
Domain d1ntmc2: 1ntm C:2-260 [92126] Other proteins in same PDB: d1ntma1, d1ntma2, d1ntmb1, d1ntmb2, d1ntmc1, d1ntmd1, d1ntmd2, d1ntme1, d1ntme2, d1ntmf_, d1ntmg_, d1ntmh_, d1ntmi_, d1ntmj_, d1ntmk_ complexed with fes, hem |
PDB Entry: 1ntm (more details), 2.4 Å
SCOP Domain Sequences for d1ntmc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntmc2 f.21.1.2 (C:2-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} tnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttt afssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilll tvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffaf hfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalml lvlfapdllgdpdnytpan
Timeline for d1ntmc2: