Lineage for d1ntme2 (1ntm E:1-69)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 426178Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 426406Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) (S)
  5. 426407Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 426408Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)
  7. 426419Species Cow (Bos taurus) [TaxId:9913] [81497] (9 PDB entries)
  8. 426423Domain d1ntme2: 1ntm E:1-69 [92130]
    Other proteins in same PDB: d1ntma1, d1ntma2, d1ntmb1, d1ntmb2, d1ntmc1, d1ntmc2, d1ntmd1, d1ntmd2, d1ntme1, d1ntmf_, d1ntmg_, d1ntmh_, d1ntmi_, d1ntmj_, d1ntmk_
    complexed with fes, hem

Details for d1ntme2

PDB Entry: 1ntm (more details), 2.4 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex at 2.4 Angstrom

SCOP Domain Sequences for d1ntme2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntme2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus)}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

SCOP Domain Coordinates for d1ntme2:

Click to download the PDB-style file with coordinates for d1ntme2.
(The format of our PDB-style files is described here.)

Timeline for d1ntme2: