| Class b: All beta proteins [48724] (176 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families) ![]() |
| Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins) |
| Protein Hypothetical protein YgfZ, C-terminal domain [101794] (1 species) |
| Species Escherichia coli [TaxId:562] [101795] (2 PDB entries) Uniprot P39179 |
| Domain d1nrka1: 1nrk A:244-325 [92089] Other proteins in same PDB: d1nrka2 structural genomics complexed with so4 |
PDB Entry: 1nrk (more details), 2.8 Å
SCOPe Domain Sequences for d1nrka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nrka1 b.44.2.1 (A:244-325) Hypothetical protein YgfZ, C-terminal domain {Escherichia coli [TaxId: 562]}
nkralwllagsasrlpeagedlelkmgenwrrtgtvlaavkledgqvvvqvvmnndmepd
sifrvrddantlhieplpysle
Timeline for d1nrka1: