Lineage for d1nrka1 (1nrk A:244-325)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2793864Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2794092Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families) (S)
  5. 2794093Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins)
  6. 2794108Protein Hypothetical protein YgfZ, C-terminal domain [101794] (1 species)
  7. 2794109Species Escherichia coli [TaxId:562] [101795] (2 PDB entries)
    Uniprot P39179
  8. 2794111Domain d1nrka1: 1nrk A:244-325 [92089]
    Other proteins in same PDB: d1nrka2
    structural genomics
    complexed with so4

Details for d1nrka1

PDB Entry: 1nrk (more details), 2.8 Å

PDB Description: ygfz protein
PDB Compounds: (A:) YGFZ Protein

SCOPe Domain Sequences for d1nrka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nrka1 b.44.2.1 (A:244-325) Hypothetical protein YgfZ, C-terminal domain {Escherichia coli [TaxId: 562]}
nkralwllagsasrlpeagedlelkmgenwrrtgtvlaavkledgqvvvqvvmnndmepd
sifrvrddantlhieplpysle

SCOPe Domain Coordinates for d1nrka1:

Click to download the PDB-style file with coordinates for d1nrka1.
(The format of our PDB-style files is described here.)

Timeline for d1nrka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nrka2