Lineage for d1nrka1 (1nrk A:244-325)
- Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds) 
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
barrel, closed; n=6, S=10; greek-keySuperfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (1 family) 
Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (2 proteins) 
Protein Hypothetical protein YgfZ, C-terminal domain [101794] (1 species) Species Escherichia coli [TaxId:562] [101795] (1 PDB entry) 
Domain d1nrka1: 1nrk A:244-325 [92089]
Other proteins in same PDB: d1nrka2
structural genomics
complexed with so4
Details for d1nrka1
PDB Entry: 1nrk (more details), 2.8 Å
PDB Description: ygfz protein
SCOP Domain Sequences for d1nrka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nrka1 b.44.2.1 (A:244-325) Hypothetical protein YgfZ, C-terminal domain {Escherichia coli}
nkralwllagsasrlpeagedlelkmgenwrrtgtvlaavkledgqvvvqvvmnndmepd
sifrvrddantlhieplpysle
SCOP Domain Coordinates for d1nrka1:
Click to download the PDB-style file with coordinates for d1nrka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nrka1:
- d1nrka1 is new in SCOP 1.67
- d1nrka1 appears in SCOP 1.69
- d1nrka1 appears in the current release, SCOPe 2.08
View in 3D
