Lineage for d1njjc2 (1njj C:44-283)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829052Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 2829053Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins)
  6. 2829104Protein Eukaryotic ornithine decarboxylase [51423] (3 species)
  7. 2829110Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51426] (5 PDB entries)
    Uniprot P07805
  8. 2829125Domain d1njjc2: 1njj C:44-283 [91910]
    Other proteins in same PDB: d1njja1, d1njjb1, d1njjc1, d1njjd1
    complexed with get, orx

Details for d1njjc2

PDB Entry: 1njj (more details), 2.45 Å

PDB Description: crystal structure determination of t. brucei ornithine decarboxylase bound to d-ornithine and to g418
PDB Compounds: (C:) ornithine decarboxylase

SCOPe Domain Sequences for d1njjc2:

Sequence, based on SEQRES records: (download)

>d1njjc2 c.1.6.1 (C:44-283) Eukaryotic ornithine decarboxylase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
dlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristddslar
crlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgt
elgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

Sequence, based on observed residues (ATOM records): (download)

>d1njjc2 c.1.6.1 (C:44-283) Eukaryotic ornithine decarboxylase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
dlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristvkfgak
vedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhild
igggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

SCOPe Domain Coordinates for d1njjc2:

Click to download the PDB-style file with coordinates for d1njjc2.
(The format of our PDB-style files is described here.)

Timeline for d1njjc2: