Lineage for d1njja1 (1njj A:20-43,A:284-414)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2390559Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2390884Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 2390920Family b.49.2.3: Eukaryotic ODC-like [88683] (2 protein domains)
    barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel
  6. 2390937Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species)
  7. 2390943Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [50628] (5 PDB entries)
    Uniprot P07805
  8. 2390956Domain d1njja1: 1njj A:20-43,A:284-414 [91905]
    Other proteins in same PDB: d1njja2, d1njjb2, d1njjc2, d1njjd2
    complexed with get, orx

Details for d1njja1

PDB Entry: 1njj (more details), 2.45 Å

PDB Description: crystal structure determination of t. brucei ornithine decarboxylase bound to d-ornithine and to g418
PDB Compounds: (A:) ornithine decarboxylase

SCOPe Domain Sequences for d1njja1:

Sequence, based on SEQRES records: (download)

>d1njja1 b.49.2.3 (A:20-43,A:284-414) Eukaryotic ornithine decarboxylase (ODC) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
ntrdalckkismntcdegdpffvaXftlavnviakkvtpgvqtdvgahaesnaqsfmyyv
ndgvygsfncilydhavvrplpqrepipneklypssvwgptcdgldqiveryylpemqvg
ewllfedmgaytvvgtssfngfqsptiyyvvsglpd

Sequence, based on observed residues (ATOM records): (download)

>d1njja1 b.49.2.3 (A:20-43,A:284-414) Eukaryotic ornithine decarboxylase (ODC) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
ntrdalckkgdpffvaXftlavnviakkvtqsfmyyvndgvygsfncilydhavvrplpq
repeklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvsptiyyvvsglpd

SCOPe Domain Coordinates for d1njja1:

Click to download the PDB-style file with coordinates for d1njja1.
(The format of our PDB-style files is described here.)

Timeline for d1njja1: