Lineage for d1istb_ (1ist B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2806647Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2806648Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2806651Species Baker's yeast (Saccharomyces cerevisiae), variant A [TaxId:4932] [101878] (1 PDB entry)
    3jb9 chain d is cyclophilin from fission yeast; not included because sids are not case sensitive
  8. 2806653Domain d1istb_: 1ist B: [90693]

Details for d1istb_

PDB Entry: 1ist (more details), 1.9 Å

PDB Description: crystal structure of yeast cyclophilin a, cpr1
PDB Compounds: (B:) cyclophilin a

SCOPe Domain Sequences for d1istb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1istb_ b.62.1.1 (B:) Cyclophilin (eukaryotic) {Baker's yeast (Saccharomyces cerevisiae), variant A [TaxId: 4932]}
sqvyfdveadgqpigrvvfklyndivpktaenfralctgekgfgyagspfhrvipdfmlq
ggdftagngtggksiyggkfpdenfkkhhdrpgllsmanagpntngsqffittvpcpwld
gkhvvfgevvdgydivkkveslgspsgatkarivvaksgel

SCOPe Domain Coordinates for d1istb_:

Click to download the PDB-style file with coordinates for d1istb_.
(The format of our PDB-style files is described here.)

Timeline for d1istb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ista_