| Class b: All beta proteins [48724] (180 folds) |
| Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
| Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
| Protein Cyclophilin (eukaryotic) [50893] (13 species) |
| Species Baker's yeast (Saccharomyces cerevisiae), variant A [TaxId:4932] [101878] (1 PDB entry) 3jb9 chain d is cyclophilin from fission yeast; not included because sids are not case sensitive |
| Domain d1istb_: 1ist B: [90693] |
PDB Entry: 1ist (more details), 1.9 Å
SCOPe Domain Sequences for d1istb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1istb_ b.62.1.1 (B:) Cyclophilin (eukaryotic) {Baker's yeast (Saccharomyces cerevisiae), variant A [TaxId: 4932]}
sqvyfdveadgqpigrvvfklyndivpktaenfralctgekgfgyagspfhrvipdfmlq
ggdftagngtggksiyggkfpdenfkkhhdrpgllsmanagpntngsqffittvpcpwld
gkhvvfgevvdgydivkkveslgspsgatkarivvaksgel
Timeline for d1istb_: