Lineage for d1istb_ (1ist B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 379249Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 379250Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 379251Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 379258Protein Cyclophilin (eukaryotic) [50893] (9 species)
  7. 379259Species Baker's yeast (Saccharomyces cerevisiae), variant A [TaxId:4932] [101878] (1 PDB entry)
  8. 379261Domain d1istb_: 1ist B: [90693]

Details for d1istb_

PDB Entry: 1ist (more details), 1.9 Å

PDB Description: crystal structure of yeast cyclophilin a, cpr1

SCOP Domain Sequences for d1istb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1istb_ b.62.1.1 (B:) Cyclophilin (eukaryotic) {Baker's yeast (Saccharomyces cerevisiae), variant A}
sqvyfdveadgqpigrvvfklyndivpktaenfralctgekgfgyagspfhrvipdfmlq
ggdftagngtggksiyggkfpdenfkkhhdrpgllsmanagpntngsqffittvpcpwld
gkhvvfgevvdgydivkkveslgspsgatkarivvaksgel

SCOP Domain Coordinates for d1istb_:

Click to download the PDB-style file with coordinates for d1istb_.
(The format of our PDB-style files is described here.)

Timeline for d1istb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ista_