![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.128: DNA polymerase III chi subunit [102399] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 7 strands, order 7165243 |
![]() | Superfamily c.128.1: DNA polymerase III chi subunit [102400] (1 family) ![]() structural similarity and possible evolutionary relationship to the AAA domain; lacks the P-loop motif automatically mapped to Pfam PF04364 |
![]() | Family c.128.1.1: DNA polymerase III chi subunit [102401] (2 proteins) |
![]() | Protein DNA polymerase III chi subunit [102402] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [102403] (1 PDB entry) |
![]() | Domain d1em8c_: 1em8 C: [90459] Other proteins in same PDB: d1em8b_, d1em8d_ |
PDB Entry: 1em8 (more details), 2.1 Å
SCOPe Domain Sequences for d1em8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1em8c_ c.128.1.1 (C:) DNA polymerase III chi subunit {Escherichia coli [TaxId: 562]} mknatfylldndttvdglsaveqlvceiaaerwrsgkrvliacedekqayrldealwarp aesfvphnlagegprggapveiawpqkrsssrrdilislrtsfadfataftevvdfvpye dslkqlarerykayrvagfnlntatwk
Timeline for d1em8c_: