Lineage for d1em8c_ (1em8 C:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 405079Fold c.128: DNA polymerase III chi subunit [102399] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 7 strands, order 7165243
  4. 405080Superfamily c.128.1: DNA polymerase III chi subunit [102400] (1 family) (S)
    structural similarity and possible evolutionary relationship to the AAA domain; lacks the P-loop motif
  5. 405081Family c.128.1.1: DNA polymerase III chi subunit [102401] (1 protein)
  6. 405082Protein DNA polymerase III chi subunit [102402] (1 species)
  7. 405083Species Escherichia coli [TaxId:562] [102403] (1 PDB entry)
  8. 405085Domain d1em8c_: 1em8 C: [90459]
    Other proteins in same PDB: d1em8b_, d1em8d_

Details for d1em8c_

PDB Entry: 1em8 (more details), 2.1 Å

PDB Description: crystal structure of chi and psi subunit heterodimer from dna pol iii

SCOP Domain Sequences for d1em8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1em8c_ c.128.1.1 (C:) DNA polymerase III chi subunit {Escherichia coli}
mknatfylldndttvdglsaveqlvceiaaerwrsgkrvliacedekqayrldealwarp
aesfvphnlagegprggapveiawpqkrsssrrdilislrtsfadfataftevvdfvpye
dslkqlarerykayrvagfnlntatwk

SCOP Domain Coordinates for d1em8c_:

Click to download the PDB-style file with coordinates for d1em8c_.
(The format of our PDB-style files is described here.)

Timeline for d1em8c_: