PDB entry 1em8

View 1em8 on RCSB PDB site
Description: Crystal structure of chi and psi subunit heterodimer from DNA POL III
Class: gene regulation
Keywords: DNA Pol III, heterodimer, clamp-loader, alpha-beta fold, GENE REGULATION
Deposited on 2000-03-16, released 2003-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.229
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase III chi subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1em8a_
  • Chain 'B':
    Compound: DNA polymerase III psi subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1em8b_
  • Chain 'C':
    Compound: DNA polymerase III chi subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1em8c_
  • Chain 'D':
    Compound: DNA polymerase III psi subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1em8d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1em8A (A:)
    mknatfylldndttvdglsaveqlvceiaaerwrsgkrvliacedekqayrldealwarp
    aesfvphnlagegprggapveiawpqkrsssrrdilislrtsfadfataftevvdfvpye
    dslkqlarerykayrvagfnlntatwk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1em8B (B:)
    qgeiaiaipahvrlvmvandlpaltdplvsdvlraltvspdqvlqltpekiamlpqgshc
    nswrlgtdeplslegaqvaspaltdlranptaraalwqqictyehdffprnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1em8B (B:)
    geiaiaipahvrlvmvandlpaltdplvsdvlraltvspdqvlqltpekiamlpqgshcn
    swrlgtdeplslegaqvaspaltdlranptaraalwqqictyehdffprn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1em8C (C:)
    mknatfylldndttvdglsaveqlvceiaaerwrsgkrvliacedekqayrldealwarp
    aesfvphnlagegprggapveiawpqkrsssrrdilislrtsfadfataftevvdfvpye
    dslkqlarerykayrvagfnlntatwk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1em8D (D:)
    qgeiaiaipahvrlvmvandlpaltdplvsdvlraltvspdqvlqltpekiamlpqgshc
    nswrlgtdeplslegaqvaspaltdlranptaraalwqqictyehdffprnd