Lineage for d1em8b_ (1em8 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2493799Fold c.126: DNA polymerase III psi subunit [102219] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2493800Superfamily c.126.1: DNA polymerase III psi subunit [102220] (1 family) (S)
    automatically mapped to Pfam PF03603
  5. 2493801Family c.126.1.1: DNA polymerase III psi subunit [102221] (1 protein)
  6. 2493802Protein DNA polymerase III psi subunit [102222] (1 species)
  7. 2493803Species Escherichia coli [TaxId:562] [102223] (1 PDB entry)
  8. 2493804Domain d1em8b_: 1em8 B: [90458]
    Other proteins in same PDB: d1em8a_, d1em8c_

Details for d1em8b_

PDB Entry: 1em8 (more details), 2.1 Å

PDB Description: crystal structure of chi and psi subunit heterodimer from dna pol iii
PDB Compounds: (B:) DNA polymerase III psi subunit

SCOPe Domain Sequences for d1em8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1em8b_ c.126.1.1 (B:) DNA polymerase III psi subunit {Escherichia coli [TaxId: 562]}
geiaiaipahvrlvmvandlpaltdplvsdvlraltvspdqvlqltpekiamlpqgshcn
swrlgtdeplslegaqvaspaltdlranptaraalwqqictyehdffprn

SCOPe Domain Coordinates for d1em8b_:

Click to download the PDB-style file with coordinates for d1em8b_.
(The format of our PDB-style files is described here.)

Timeline for d1em8b_: