Lineage for d1uc5a_ (1uc5 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089476Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (4 families) (S)
  5. 2089521Family c.1.19.3: Diol dehydratase, alpha subunit [51710] (2 protein domains)
    automatically mapped to Pfam PF02286
  6. 2089522Protein Diol dehydratase, alpha subunit [51711] (2 species)
  7. 2089523Species Klebsiella oxytoca [TaxId:571] [51712] (7 PDB entries)
  8. 2089536Domain d1uc5a_: 1uc5 A: [88456]
    Other proteins in same PDB: d1uc5b_, d1uc5e_, d1uc5g_, d1uc5m_
    complexed with cnc, k, nh4, pgr

Details for d1uc5a_

PDB Entry: 1uc5 (more details), 2.3 Å

PDB Description: Structure of diol dehydratase complexed with (R)-1,2-propanediol
PDB Compounds: (A:) diol dehydrase alpha subunit

SCOPe Domain Sequences for d1uc5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uc5a_ c.1.19.3 (A:) Diol dehydratase, alpha subunit {Klebsiella oxytoca [TaxId: 571]}
mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
iknipgaldpn

SCOPe Domain Coordinates for d1uc5a_:

Click to download the PDB-style file with coordinates for d1uc5a_.
(The format of our PDB-style files is described here.)

Timeline for d1uc5a_: