PDB entry 1uc5

View 1uc5 on RCSB PDB site
Description: Structure of diol dehydratase complexed with (R)-1,2-propanediol
Class: lyase
Keywords: ALPHA/BETA BARREL, lyase
Deposited on 2003-04-08, released 2003-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.208
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diol dehydrase alpha subunit
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uc5a_
  • Chain 'B':
    Compound: diol dehydrase beta subunit
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uc5b_
  • Chain 'E':
    Compound: diol dehydrase beta subunit
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uc5e_
  • Chain 'G':
    Compound: diol dehydrase gamma subunit
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uc5g_
  • Chain 'L':
    Compound: diol dehydrase alpha subunit
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uc5l_
  • Chain 'M':
    Compound: diol dehydrase gamma subunit
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uc5m_
  • Heterogens: K, NH4, CNC, PGR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uc5A (A:)
    mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
    lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
    nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
    fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
    skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
    scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
    ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
    avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
    gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
    iknipgaldpneid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uc5A (A:)
    mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
    lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
    nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
    fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
    skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
    scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
    ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
    avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
    gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
    iknipgaldpn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uc5B (B:)
    meinekllrqiiedvlsemkgsdkpvsfnapaasaapqatppagdgfltevgearqgtqq
    deviiavgpafglaqtvnivgiphksilreviagieeegikarvircfkssdvafvaveg
    nrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltletyrqigknaaryakres
    pqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrval
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uc5B (B:)
    gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
    rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
    rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrva
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1uc5E (E:)
    meinekllrqiiedvlsemkgsdkpvsfnapaasaapqatppagdgfltevgearqgtqq
    deviiavgpafglaqtvnivgiphksilreviagieeegikarvircfkssdvafvaveg
    nrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltletyrqigknaaryakres
    pqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrval
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uc5E (E:)
    gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
    rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
    rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1uc5G (G:)
    mntdaiesmvrdvlsrmnslqgeapaaapaaggasrsarvsdyplankhpewvktatnkt
    lddftlenvlsnkvtaqdmritpetlrlqasiakdagrdrlamnferaaeltavpddril
    eiynalrpyrstkeellaiaddlesryqakicaafvreaatlyverkklkgdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uc5G (G:)
    sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
    grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
    reaatlyverkklkgdd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1uc5L (L:)
    mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
    lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
    nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
    fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
    skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
    scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
    ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
    avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
    gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
    iknipgaldpneid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uc5L (L:)
    mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
    lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
    nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
    fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
    skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
    scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
    ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
    avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
    gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
    iknipgaldpn
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1uc5M (M:)
    mntdaiesmvrdvlsrmnslqgeapaaapaaggasrsarvsdyplankhpewvktatnkt
    lddftlenvlsnkvtaqdmritpetlrlqasiakdagrdrlamnferaaeltavpddril
    eiynalrpyrstkeellaiaddlesryqakicaafvreaatlyverkklkgdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uc5M (M:)
    sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
    grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
    reaatlyverkklkgdd