Lineage for d1uc5e_ (1uc5 E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2882071Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families) (S)
  5. 2882072Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein)
    contains additional structures in the C-terminal extension
  6. 2882073Protein Diol dehydratase, beta subunit [52970] (2 species)
  7. 2882074Species Klebsiella oxytoca [TaxId:571] [52971] (11 PDB entries)
  8. 2882098Domain d1uc5e_: 1uc5 E: [88458]
    Other proteins in same PDB: d1uc5a_, d1uc5g_, d1uc5l_, d1uc5m_
    complexed with cnc, k, nh4, pgr

Details for d1uc5e_

PDB Entry: 1uc5 (more details), 2.3 Å

PDB Description: structure of diol dehydratase complexed with (r)-1,2-propanediol
PDB Compounds: (E:) diol dehydrase beta subunit

SCOPe Domain Sequences for d1uc5e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uc5e_ c.51.3.1 (E:) Diol dehydratase, beta subunit {Klebsiella oxytoca [TaxId: 571]}
gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrv

SCOPe Domain Coordinates for d1uc5e_:

Click to download the PDB-style file with coordinates for d1uc5e_.
(The format of our PDB-style files is described here.)

Timeline for d1uc5e_: