![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families) ![]() |
![]() | Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein) contains additional structures in the C-terminal extension |
![]() | Protein Diol dehydratase, beta subunit [52970] (2 species) |
![]() | Species Klebsiella oxytoca [TaxId:571] [52971] (11 PDB entries) |
![]() | Domain d1uc5e_: 1uc5 E: [88458] Other proteins in same PDB: d1uc5a_, d1uc5g_, d1uc5l_, d1uc5m_ complexed with cnc, k, nh4, pgr |
PDB Entry: 1uc5 (more details), 2.3 Å
SCOPe Domain Sequences for d1uc5e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uc5e_ c.51.3.1 (E:) Diol dehydratase, beta subunit {Klebsiella oxytoca [TaxId: 571]} gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrv
Timeline for d1uc5e_: