SCOP 1.75: Domain d1pvnb1: 1pvn B:2-99,B:231-494

Lineage for d1pvnb1 (1pvn B:2-99,B:231-494)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (1 family)
   The phosphate moiety of substrate binds in the 'common' phosphate-binding site

5. Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)

6. Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (8 species)

7. Species Tritrichomonas foetus [TaxId:5724] [51417] (9 PDB entries)

8. Domain d1pvnb1: 1pvn B:2-99,B:231-494 [88313]
   there are two CBS domains in the disordered region 100-230

Details for d1pvnb1

PDB Entry: 1pvn, 2 Å

PDB Description: the crystal structure of the complex between imp dehydrogenase catalytic domain and a transition state analogue mzp

PDB Compounds: (B:) inosine-5'-monophosphate dehydrogenase

SCOP Domain Sequences for d1pvnb1:

Sequence; same for both SEQRES and ATOM records:

>d1pvnb1 c.1.5.1 (B:2-99,B:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]}
akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
vsgekmaialareggisfifgsqsiesqaamvhavknfXrylvgagintrdfrervpalv
eagadvlcidssdgfsewqkitigwirekygdkvkvgagnivdgegfryladagadfiki
gigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlal
amgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqklsfee
gvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsiveggahdv
ivk

Timeline for d1pvnb1:

• d1pvnb1 first appeared in SCOP 1.65
  
• d1pvnb1 appears in SCOP 1.73
  
• d1pvnb1 appears in SCOPe 2.01
  
• d1pvnb1 appears in the current release, SCOPe 2.08