Lineage for d1pvnb1 (1pvn B:2-99,B:231-494)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681861Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (1 family) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 681862Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)
  6. 681863Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (6 species)
  7. 681882Species Tritrichomonas foetus [TaxId:5724] [51417] (9 PDB entries)
  8. 681884Domain d1pvnb1: 1pvn B:2-99,B:231-494 [88313]

Details for d1pvnb1

PDB Entry: 1pvn (more details), 2 Å

PDB Description: the crystal structure of the complex between imp dehydrogenase catalytic domain and a transition state analogue mzp
PDB Compounds: (B:) inosine-5'-monophosphate dehydrogenase

SCOP Domain Sequences for d1pvnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvnb1 c.1.5.1 (B:2-99,B:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]}
akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
vsgekmaialareggisfifgsqsiesqaamvhavknfXrylvgagintrdfrervpalv
eagadvlcidssdgfsewqkitigwirekygdkvkvgagnivdgegfryladagadfiki
gigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlal
amgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqklsfee
gvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsiveggahdv
ivk

SCOP Domain Coordinates for d1pvnb1:

Click to download the PDB-style file with coordinates for d1pvnb1.
(The format of our PDB-style files is described here.)

Timeline for d1pvnb1: