Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (1 family) The phosphate moiety of substrate binds in the 'common' phosphate-binding site |
Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein) |
Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (6 species) |
Species Tritrichomonas foetus [TaxId:5724] [51417] (5 PDB entries) |
Domain d1pvnb1: 1pvn B:2-99,B:231-494 [88313] |
PDB Entry: 1pvn (more details), 2 Å
SCOP Domain Sequences for d1pvnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pvnb1 c.1.5.1 (B:2-99,B:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus} akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs vsgekmaialareggisfifgsqsiesqaamvhavknfXrylvgagintrdfrervpalv eagadvlcidssdgfsewqkitigwirekygdkvkvgagnivdgegfryladagadfiki gigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlal amgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqklsfee gvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsiveggahdv ivk
Timeline for d1pvnb1: