Lineage for d1pvnb1 (1pvn B:2-99,B:231-494)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305504Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (1 family) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 305505Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)
  6. 305506Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (6 species)
  7. 305521Species Tritrichomonas foetus [TaxId:5724] [51417] (5 PDB entries)
  8. 305524Domain d1pvnb1: 1pvn B:2-99,B:231-494 [88313]

Details for d1pvnb1

PDB Entry: 1pvn (more details), 2 Å

PDB Description: the crystal structure of the complex between imp dehydrogenase catalytic domain and a transition state analogue mzp

SCOP Domain Sequences for d1pvnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvnb1 c.1.5.1 (B:2-99,B:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus}
akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
vsgekmaialareggisfifgsqsiesqaamvhavknfXrylvgagintrdfrervpalv
eagadvlcidssdgfsewqkitigwirekygdkvkvgagnivdgegfryladagadfiki
gigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlal
amgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqklsfee
gvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsiveggahdv
ivk

SCOP Domain Coordinates for d1pvnb1:

Click to download the PDB-style file with coordinates for d1pvnb1.
(The format of our PDB-style files is described here.)

Timeline for d1pvnb1: