Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (9 species) |
Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
Domain d1pnuh_: 1pnu H: [88205] 50S subunit; the coordinates of 30S subunit in 1pns protein/RNA complex |
PDB Entry: 1pnu (more details), 8.7 Å
SCOPe Domain Sequences for d1pnuh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pnuh_ i.1.1.1 (H:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} vktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqv altgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrl kvyagethphsaqkpqvlktqpl
Timeline for d1pnuh_:
View in 3D Domains from other chains: (mouse over for more information) d1pnu1_, d1pnu2_, d1pnu3_, d1pnu4_, d1pnu5_, d1pnua_, d1pnub_, d1pnuc_, d1pnud_, d1pnue_, d1pnuf_, d1pnug_, d1pnui_, d1pnuj_, d1pnuk_, d1pnul_, d1pnum_, d1pnun_, d1pnuo_, d1pnup_, d1pnuq_, d1pnur_, d1pnus_, d1pnut_, d1pnuu_, d1pnuv_, d1pnuw_, d1pnux_, d1pnuy_, d1pnuz_ |