Lineage for d1pnud_ (1pnu D:)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1069523Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1069524Protein 70S ribosome functional complex [58121] (9 species)
  7. 1069596Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1069837Domain d1pnud_: 1pnu D: [88201]
    50S subunit; the coordinates of 30S subunit in 1pns
    protein/RNA complex

Details for d1pnud_

PDB Entry: 1pnu (more details), 8.7 Å

PDB Description: crystal structure of a streptomycin dependent ribosome from escherichia coli, 50s subunit of 70s ribosome. this file, 1pnu, contains only molecules of the 50s ribosomal subunit. the 30s subunit, mrna, p-site trna, and a-site trna are in the pdb file 1pns.
PDB Compounds: (D:) 50S ribosomal protein L5

SCOPe Domain Sequences for d1pnud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnud_ i.1.1.1 (D:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
qqlktkyndqvrpalmqqfgyssvmavpriekivvneglgsskedskaidkaakelalit
lqkpiitkakksisnfklrqgmpvgikvtlrgermyvflekliniglprirdfrginpna
fdgrgnynlgikeqlifpeitydmvdktrgmditivttaktdeearallqsmglpfrk

SCOPe Domain Coordinates for d1pnud_:

Click to download the PDB-style file with coordinates for d1pnud_.
(The format of our PDB-style files is described here.)

Timeline for d1pnud_: