Lineage for d1pjlh2 (1pjl H:7023-7279)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498096Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2498097Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2498325Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins)
    Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand
  6. 2498332Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species)
  7. 2498350Species Human (Homo sapiens) [TaxId:9606] [53242] (10 PDB entries)
  8. 2498392Domain d1pjlh2: 1pjl H:7023-7279 [88138]
    Other proteins in same PDB: d1pjla1, d1pjlb1, d1pjlc1, d1pjld1, d1pjle1, d1pjlf1, d1pjlg1, d1pjlh1
    complexed with lu, nad

Details for d1pjlh2

PDB Entry: 1pjl (more details), 2.9 Å

PDB Description: crystal structure of human m-nad-me in ternary complex with nad and lu3+
PDB Compounds: (H:) NAD-dependent malic enzyme, mitochondrial

SCOPe Domain Sequences for d1pjlh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjlh2 c.58.1.3 (H:7023-7279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
ekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtspleky
iyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdrgh
vrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclpvc
idvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnhna
frflrkyrekyctfndd

SCOPe Domain Coordinates for d1pjlh2:

Click to download the PDB-style file with coordinates for d1pjlh2.
(The format of our PDB-style files is described here.)

Timeline for d1pjlh2: