SCOPe 2.07: Domain d1pjlg2: 1pjl G:6023-6279

Lineage for d1pjlg2 (1pjl G:6023-6279)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins)
   Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand

6. Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53242] (10 PDB entries)

8. Domain d1pjlg2: 1pjl G:6023-6279 [88136]
   Other proteins in same PDB: d1pjla1, d1pjlb1, d1pjlc1, d1pjld1, d1pjle1, d1pjlf1, d1pjlg1, d1pjlh1
   complexed with lu, nad

Details for d1pjlg2

PDB Entry: 1pjl, 2.9 Å

PDB Description: crystal structure of human m-nad-me in ternary complex with nad and lu3+

PDB Compounds: (G:) NAD-dependent malic enzyme, mitochondrial

SCOPe Domain Sequences for d1pjlg2:

Sequence; same for both SEQRES and ATOM records:

>d1pjlg2 c.58.1.3 (G:6023-6279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
ekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtspleky
iyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdrgh
vrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclpvc
idvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnhna
frflrkyrekyctfndd

Timeline for d1pjlg2:

• d1pjlg2 first appeared in SCOP 1.65
  
• d1pjlg2 appears in SCOPe 2.06
  
• d1pjlg2 appears in the current release, SCOPe 2.08