Lineage for d1pjlc1 (1pjl C:2280-2573)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2453552Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2453716Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species)
    includes C-terminal additional subdomains
  7. 2453734Species Human (Homo sapiens) [TaxId:9606] [51899] (10 PDB entries)
  8. 2453771Domain d1pjlc1: 1pjl C:2280-2573 [88127]
    Other proteins in same PDB: d1pjla2, d1pjlb2, d1pjlc2, d1pjld2, d1pjle2, d1pjlf2, d1pjlg2, d1pjlh2
    complexed with lu, nad

Details for d1pjlc1

PDB Entry: 1pjl (more details), 2.9 Å

PDB Description: crystal structure of human m-nad-me in ternary complex with nad and lu3+
PDB Compounds: (C:) NAD-dependent malic enzyme, mitochondrial

SCOPe Domain Sequences for d1pjlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjlc1 c.2.1.7 (C:2280-2573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk
kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf
tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv
ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani
qevsiniaikvteylyankmafrypepedkakyvkertwrseydsllpdvyewp

SCOPe Domain Coordinates for d1pjlc1:

Click to download the PDB-style file with coordinates for d1pjlc1.
(The format of our PDB-style files is described here.)

Timeline for d1pjlc1: