SCOP 1.65: Domain d1p5ua1: 1p5u A:9-147

Lineage for d1p5ua1 (1p5u A:9-147)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (2 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (4 proteins)

6. Protein Chaperone protein Caf1m [89205] (1 species)

7. Species Yersinia pestis [TaxId:632] [89206] (2 PDB entries)

8. Domain d1p5ua1: 1p5u A:9-147 [87808]
   Other proteins in same PDB: d1p5ua2, d1p5ub_, d1p5uc_
   mutant

Details for d1p5ua1

PDB Entry: 1p5u, 1.99 Å

PDB Description: x-ray structure of the ternary caf1m:caf1:caf1 chaperone:subunit:subunit complex

SCOP Domain Sequences for d1p5ua1:

Sequence, based on SEQRES records:

>d1p5ua1 b.1.11.1 (A:9-147) Chaperone protein Caf1m {Yersinia pestis}
skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplf
rldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnpdkdvgv
fvqfainncikllvrpnel

Sequence, based on observed residues (ATOM records):

>d1p5ua1 b.1.11.1 (A:9-147) Chaperone protein Caf1m {Yersinia pestis}
skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkepfvvtpplfrldak
qqnslriaqaggvfprdkeslkwlcvkgippkdpdkdvgvfvqfainncikllvrpnel

Timeline for d1p5ua1:

• d1p5ua1 is new in SCOP 1.65
  
• d1p5ua1 appears in SCOP 1.67
  
• d1p5ua1 appears in the current release, SCOPe 2.08