Lineage for d1p5ua1 (1p5u A:9-147)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291332Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 291333Family b.1.11.1: Pilus chaperone [49355] (4 proteins)
  6. 291334Protein Chaperone protein Caf1m [89205] (1 species)
  7. 291335Species Yersinia pestis [TaxId:632] [89206] (2 PDB entries)
  8. 291337Domain d1p5ua1: 1p5u A:9-147 [87808]
    Other proteins in same PDB: d1p5ua2, d1p5ub_, d1p5uc_
    mutant

Details for d1p5ua1

PDB Entry: 1p5u (more details), 1.99 Å

PDB Description: X-ray structure of the ternary Caf1M:Caf1:Caf1 chaperone:subunit:subunit complex

SCOP Domain Sequences for d1p5ua1:

Sequence, based on SEQRES records: (download)

>d1p5ua1 b.1.11.1 (A:9-147) Chaperone protein Caf1m {Yersinia pestis}
skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplf
rldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnpdkdvgv
fvqfainncikllvrpnel

Sequence, based on observed residues (ATOM records): (download)

>d1p5ua1 b.1.11.1 (A:9-147) Chaperone protein Caf1m {Yersinia pestis}
skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkepfvvtpplfrldak
qqnslriaqaggvfprdkeslkwlcvkgippkdpdkdvgvfvqfainncikllvrpnel

SCOP Domain Coordinates for d1p5ua1:

Click to download the PDB-style file with coordinates for d1p5ua1.
(The format of our PDB-style files is described here.)

Timeline for d1p5ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p5ua2