SCOP 1.65: Domain d1p5ua2: 1p5u A:148-234

Lineage for d1p5ua2 (1p5u A:148-234)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.7: C2 domain-like [49561] (4 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family)

5. Family b.7.2.1: Periplasmic chaperone C-domain [49585] (4 proteins)

6. Protein Caf1m [89221] (1 species)
   chaperone of F1 capsule antigen Caf1

7. Species Yersinia pestis [TaxId:632] [89222] (2 PDB entries)

8. Domain d1p5ua2: 1p5u A:148-234 [87809]
   Other proteins in same PDB: d1p5ua1, d1p5ub_, d1p5uc_
   mutant

Details for d1p5ua2

PDB Entry: 1p5u, 1.99 Å

PDB Description: x-ray structure of the ternary caf1m:caf1:caf1 chaperone:subunit:subunit complex

SCOP Domain Sequences for d1p5ua2:

Sequence; same for both SEQRES and ATOM records:

>d1p5ua2 b.7.2.1 (A:148-234) Caf1m {Yersinia pestis}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkg
lagarnvswriindqggldrlysknvt

Timeline for d1p5ua2:

• d1p5ua2 is new in SCOP 1.65
  
• d1p5ua2 appears in SCOP 1.67
  
• d1p5ua2 appears in the current release, SCOPe 2.08