Lineage for d1p5uc_ (1p5u C:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 291903Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 291971Superfamily b.2.3: Bacterial adhesins [49401] (5 families) (S)
  5. 291976Family b.2.3.2: Pilus subunits [49405] (4 proteins)
  6. 291977Protein F1 capsule antigen Caf1 [89213] (1 species)
  7. 291978Species Yersinia pestis [TaxId:632] [89214] (2 PDB entries)
  8. 291981Domain d1p5uc_: 1p5u C: [87811]
    Other proteins in same PDB: d1p5ua1, d1p5ua2
    mutant

Details for d1p5uc_

PDB Entry: 1p5u (more details), 1.99 Å

PDB Description: x-ray structure of the ternary caf1m:caf1:caf1 chaperone:subunit:subunit complex

SCOP Domain Sequences for d1p5uc_:

Sequence, based on SEQRES records: (download)

>d1p5uc_ b.2.3.2 (C:) F1 capsule antigen Caf1 {Yersinia pestis}
paritltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltft
sqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggklaa
gkytdavtvtvsnq

Sequence, based on observed residues (ATOM records): (download)

>d1p5uc_ b.2.3.2 (C:) F1 capsule antigen Caf1 {Yersinia pestis}
paritltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltft
sqdgnnhqfttkvigkdsrdfdispkvngendvvlatgsqdffvrsigskggklaagkyt
davtvtvsnq

SCOP Domain Coordinates for d1p5uc_:

Click to download the PDB-style file with coordinates for d1p5uc_.
(The format of our PDB-style files is described here.)

Timeline for d1p5uc_: