Lineage for d1p5ua1 (1p5u A:9-147)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764596Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2764597Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
    automatically mapped to Pfam PF00345
  6. 2764598Protein Chaperone protein Caf1m [89205] (1 species)
  7. 2764599Species Yersinia pestis [TaxId:632] [89206] (8 PDB entries)
  8. 2764600Domain d1p5ua1: 1p5u A:9-147 [87808]
    Other proteins in same PDB: d1p5ua2, d1p5ub_, d1p5uc_

Details for d1p5ua1

PDB Entry: 1p5u (more details), 1.99 Å

PDB Description: x-ray structure of the ternary caf1m:caf1:caf1 chaperone:subunit:subunit complex
PDB Compounds: (A:) Chaperone protein Caf1M

SCOPe Domain Sequences for d1p5ua1:

Sequence, based on SEQRES records: (download)

>d1p5ua1 b.1.11.1 (A:9-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplf
rldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnpdkdvgv
fvqfainncikllvrpnel

Sequence, based on observed residues (ATOM records): (download)

>d1p5ua1 b.1.11.1 (A:9-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkepfvvtpplfrldak
qqnslriaqaggvfprdkeslkwlcvkgippkdpdkdvgvfvqfainncikllvrpnel

SCOPe Domain Coordinates for d1p5ua1:

Click to download the PDB-style file with coordinates for d1p5ua1.
(The format of our PDB-style files is described here.)

Timeline for d1p5ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p5ua2