SCOPe 2.06: Domain d1p4qa1: 1p4q A:9-52

Lineage for d1p4qa1 (1p4q A:9-52)

1. Root: SCOPe 2.06

2. Class j: Peptides [58231] (133 folds)

3. Fold j.96: Transactivation domain [81275] (1 superfamily)

4. Superfamily j.96.1: Transactivation domain [74800] (1 family)

5. Family j.96.1.1: Transactivation domain [74801] (2 proteins)

6. Protein Cbp/p300-interacting transactivator 2, Cited2 [90295] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90296] (2 PDB entries)

8. Domain d1p4qa1: 1p4q A:9-52 [87777]
   Other proteins in same PDB: d1p4qa2, d1p4qb_
   complexed with TAZ1 domain of mouse CBP
   complexed with zn

Details for d1p4qa1

PDB Entry: 1p4q

PDB Description: solution structure of the cited2 transactivation domain in complex with the p300 ch1 domain

PDB Compounds: (A:) Cbp/p300-interacting transactivator 2

SCOPe Domain Sequences for d1p4qa1:

Sequence; same for both SEQRES and ATOM records:

>d1p4qa1 j.96.1.1 (A:9-52) Cbp/p300-interacting transactivator 2, Cited2 {Human (Homo sapiens) [TaxId: 9606]}
nvidtdfideevlmslviemgldrikelpelwlgqnefdfmtdf

Timeline for d1p4qa1:

• d1p4qa1 first appeared in SCOP 1.65, called d1p4qa_
  
• d1p4qa1 was called d1p4qa_ in SCOPe 2.05
  
• d1p4qa1 appears in SCOPe 2.07
  
• d1p4qa1 appears in the current release, SCOPe 2.08