SCOP 1.65: Domain d1p4qa_: 1p4q A:

Lineage for d1p4qa_ (1p4q A:)

1. Root: SCOP 1.65

2. Class j: Peptides [58231] (105 folds)

3. Fold j.96: Transactivation domain [81275] (1 superfamily)

4. Superfamily j.96.1: Transactivation domain [74800] (1 family)

5. Family j.96.1.1: Transactivation domain [74801] (2 proteins)

6. Protein Cbp/p300-interacting transactivator 2, Cited2 [90295] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90296] (1 PDB entry)

8. Domain d1p4qa_: 1p4q A: [87777]
   Other proteins in same PDB: d1p4qb_
   complexed with TAZ1 domain of mouse CBP
   complexed with zn

Details for d1p4qa_

PDB Entry: 1p4q

PDB Description: solution structure of the cited2 transactivation domain in complex with the p300 ch1 domain

SCOP Domain Sequences for d1p4qa_:

Sequence; same for both SEQRES and ATOM records:

>d1p4qa_ j.96.1.1 (A:) Cbp/p300-interacting transactivator 2, Cited2 {Human (Homo sapiens)}
gsgsgsgsnvidtdfideevlmslviemgldrikelpelwlgqnefdfmtdf

Timeline for d1p4qa_:

• d1p4qa_ is new in SCOP 1.65
  
• d1p4qa_ appears in SCOP 1.67
  
• d1p4qa_ appears in the current release, SCOPe 2.08, called d1p4qa1